Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

TAZ Rabbit pAb (A15806)

Publications (2) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - TAZ Rabbit pAb (A15806)

Western blot analysis of extracts of various cell lines, using TAZ antibody (A15806) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunofluorescence - TAZ Rabbit pAb (A15806)

Immunofluorescence analysis of U2OS cells using TAZ antibody (A15806) at dilution of 1:100. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name TAZ Rabbit pAb
Catalog No. A15806
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Enables transcription coactivator activity. Involved in several processes, including hippo signaling; positive regulation of cell differentiation; and regulation of signal transduction. Located in cytosol and nuclear body.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 300-400 of human TAZ (NP_056287.1).
Sequence LNGGPYHSREQSTDSGLGLGCYSVPTTPEDFLSNVDEMDTGENAGQTPMNINPQQTRFPDFLDCLPGTNVDLGTLESEDLIPLFNDVESALNKSEPFLTWL
Gene ID 25937
Swiss prot Q9GZV5
Synonyms TAZ
Calculated MW 44kDa
Observed MW 55kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples NCI-H460, Mouse lung
Cellular location Cytoplasm, Nucleus
Customer validation

WB (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

TAZ Rabbit pAb images

ABclonal:Western blot - TAZ Rabbit pAb (A15806)}

Western blot - TAZ Rabbit pAb (A15806)

Western blot analysis of extracts of various cell lines, using TAZ antibody (A15806) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
ABclonal:Immunofluorescence - TAZ Rabbit pAb (A15806)}

Immunofluorescence - TAZ Rabbit pAb (A15806)

Immunofluorescence analysis of U2OS cells using TAZ antibody (A15806) at dilution of 1:100. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A15806 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on WWTR1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to WWTR1. (Distance between topics and target gene indicate popularity.) WWTR1

* Data provided by citexs.com, for reference only.

Publishing research using A15806? Please let us know so that we can cite the reference in this datasheet.

Antibodies (3)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order