Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

NFKB1 Rabbit pAb (A6667)

Reviews (2) Publications (50) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - NFKB1 Rabbit pAb (A6667)

Western blot analysis of Mouse lung, using NFKB1 antibody (A6667) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s.

ABclonal:Immunohistochemistry - NFKB1 Rabbit pAb (A6667)

Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using NFKB1 Rabbit pAb (A6667) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - NFKB1 Rabbit pAb (A6667)

Immunohistochemistry analysis of paraffin-embedded mouse intestin using NFKB1 Rabbit pAb (A6667) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - NFKB1 Rabbit pAb (A6667)

Immunohistochemistry analysis of paraffin-embedded rat lung using NFKB1 Rabbit pAb (A6667) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - NFKB1 Rabbit pAb (A6667)

Immunofluorescence analysis of A-549 cells using NFKB1 Rabbit pAb (A6667) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - NFKB1 Rabbit pAb (A6667)

Immunofluorescence analysis of NIH/3T3 cells using NFKB1 Rabbit pAb (A6667) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - NFKB1 Rabbit pAb (A6667)

Immunofluorescence analysis of U2OS cells using NFKB1 Rabbit pAb (A6667) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.

Review
ABclonal: review for NFKB1 Rabbit pAb(A6667)
Review
ABclonal: review for NFKB1 Rabbit pAb(A6667)

You may also interested in:

Overview

Product name NFKB1 Rabbit pAb
Catalog No. A6667
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a 105 kD protein which can undergo cotranslational processing by the 26S proteasome to produce a 50 kD protein. The 105 kD protein is a Rel protein-specific transcription inhibitor and the 50 kD protein is a DNA binding subunit of the NF-kappa-B (NFKB) protein complex. NFKB is a transcription regulator that is activated by various intra- and extra-cellular stimuli such as cytokines, oxidant-free radicals, ultraviolet irradiation, and bacterial or viral products. Activated NFKB translocates into the nucleus and stimulates the expression of genes involved in a wide variety of biological functions. Inappropriate activation of NFKB has been associated with a number of inflammatory diseases while persistent inhibition of NFKB leads to inappropriate immune cell development or delayed cell growth. NFKB is a critical regulator of the immediate-early response to viral infection. Alternative splicing results in multiple transcript variants encoding different isoforms, at least one of which is proteolytically processed.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 41-365 of human NFKB1 (NP_001158884.1).
Sequence GPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQAEGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQRKRQK
Gene ID 4790
Swiss prot P19838
Synonyms KBF1; EBP-1; NF-kB; CVID12; NF-kB1; NFKB-p50; NFkappaB; NF-kappaB; NFKB-p105; NF-kappa-B1; NF-kappabeta; NFKB1
Calculated MW 105kDa
Observed MW 50kDa/120kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:100 - 1:500
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples Mouse lung
Cellular location Cytoplasm, Nucleus
Customer validation

WB (BMDC, HCC827Mus musculus, Rattus norvegicus, Homo sapiens, Mus musculus, Gallus gallus)

IHC (Mus musculus, Rattus norvegicus)

IF/ICC (Mus musculus)

IF (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

NFKB1 Rabbit pAb images

ABclonal:Western blot - NFKB1 Rabbit pAb (A6667)}

Western blot - NFKB1 Rabbit pAb (A6667)

Western blot analysis of Mouse lung, using NFKB1 antibody (A6667) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s.
ABclonal:Immunohistochemistry - NFKB1 Rabbit pAb (A6667)}

Immunohistochemistry - NFKB1 Rabbit pAb (A6667)

Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using NFKB1 Rabbit pAb (A6667) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - NFKB1 Rabbit pAb (A6667)}

Immunohistochemistry - NFKB1 Rabbit pAb (A6667)

Immunohistochemistry analysis of paraffin-embedded mouse intestin using NFKB1 Rabbit pAb (A6667) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - NFKB1 Rabbit pAb (A6667)}

Immunohistochemistry - NFKB1 Rabbit pAb (A6667)

Immunohistochemistry analysis of paraffin-embedded rat lung using NFKB1 Rabbit pAb (A6667) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - NFKB1 Rabbit pAb (A6667)}

Immunofluorescence - NFKB1 Rabbit pAb (A6667)

Immunofluorescence analysis of A-549 cells using NFKB1 Rabbit pAb (A6667) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - NFKB1 Rabbit pAb (A6667)}

Immunofluorescence - NFKB1 Rabbit pAb (A6667)

Immunofluorescence analysis of NIH/3T3 cells using NFKB1 Rabbit pAb (A6667) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - NFKB1 Rabbit pAb (A6667)}

Immunofluorescence - NFKB1 Rabbit pAb (A6667)

Immunofluorescence analysis of U2OS cells using NFKB1 Rabbit pAb (A6667) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.

Submit an review for A6667

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A6667 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on NFKB1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to NFKB1. (Distance between topics and target gene indicate popularity.) NFKB1

* Data provided by citexs.com, for reference only.

Publishing research using A6667? Please let us know so that we can cite the reference in this datasheet.

Antibodies (9)

ELISA Kits (2)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order