Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

BRCA1 Rabbit pAb (A11549)

Publication (1) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Immunohistochemistry - BRCA1 Rabbit pAb (A11549)

Immunohistochemistry analysis of BRCA1 in paraffin-embedded human lung cancer using BRCA1 Rabbit pAb (A11549) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - BRCA1 Rabbit pAb (A11549)

Immunohistochemistry analysis of BRCA1 in paraffin-embedded human normal cervix using BRCA1 Rabbit pAb (A11549) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - BRCA1 Rabbit pAb (A11549)

Immunofluorescence analysis of U2OS cells using BRCA1 Rabbit pAb (A11549) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name BRCA1 Rabbit pAb
Catalog No. A11549
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a 190 kD nuclear phosphoprotein that plays a role in maintaining genomic stability, and it also acts as a tumor suppressor. The BRCA1 gene contains 22 exons spanning about 110 kb of DNA. The encoded protein combines with other tumor suppressors, DNA damage sensors, and signal transducers to form a large multi-subunit protein complex known as the BRCA1-associated genome surveillance complex (BASC). This gene product associates with RNA polymerase II, and through the C-terminal domain, also interacts with histone deacetylase complexes. This protein thus plays a role in transcription, DNA repair of double-stranded breaks, and recombination. Mutations in this gene are responsible for approximately 40% of inherited breast cancers and more than 80% of inherited breast and ovarian cancers. Alternative splicing plays a role in modulating the subcellular localization and physiological function of this gene. Many alternatively spliced transcript variants, some of which are disease-associated mutations, have been described for this gene, but the full-length natures of only some of these variants has been described. A related pseudogene, which is also located on chromosome 17, has been identified.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 901-1000 of human BRCA1 (NP_009225.1).
Sequence FECEQKEENQGKNESNIKPVQTVNITAGFPVVGQKDKPVDNAKCSIKGGSRFCLSSQFRGNETGLITPNKHGLLQNPYRIPPLFPIKSFVKTKCKKNLLE
Gene ID 672
Swiss prot P38398
Synonyms IRIS; PSCP; BRCAI; BRCC1; FANCS; PNCA4; RNF53; BROVCA1; PPP1R53; BRCA1
Calculated MW 208kDa
Observed MW Refer to figures

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Immunohistochemistry    Immunofluorescence    
Positive samples
Cellular location Chromosome, Cytoplasm, Cytoplasm, Nucleus
Customer validation

WB (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

BRCA1 Rabbit pAb images

ABclonal:Immunohistochemistry - BRCA1 Rabbit pAb (A11549)}

Immunohistochemistry - BRCA1 Rabbit pAb (A11549)

Immunohistochemistry analysis of BRCA1 in paraffin-embedded human lung cancer using BRCA1 Rabbit pAb (A11549) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - BRCA1 Rabbit pAb (A11549)}

Immunohistochemistry - BRCA1 Rabbit pAb (A11549)

Immunohistochemistry analysis of BRCA1 in paraffin-embedded human normal cervix using BRCA1 Rabbit pAb (A11549) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - BRCA1 Rabbit pAb (A11549)}

Immunofluorescence - BRCA1 Rabbit pAb (A11549)

Immunofluorescence analysis of U2OS cells using BRCA1 Rabbit pAb (A11549) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A11549 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on BRCA1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to BRCA1. (Distance between topics and target gene indicate popularity.) BRCA1

* Data provided by citexs.com, for reference only.

Publishing research using A11549? Please let us know so that we can cite the reference in this datasheet.

Antibodies (3)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order