Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

CD80 Rabbit pAb (A16039)

Publications (7) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - CD80 Rabbit pAb (A16039)

Western blot analysis of lysates from Rat lung, using CD80 Rabbit pAb (A16039) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.

ABclonal:Western blot - CD80 Rabbit pAb (A16039)

WWestern blot analysis of various lysates, using CD80 Rabbit pAb (A16039) at 1:900 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s.

ABclonal:Immunohistochemistry - CD80 Rabbit pAb (A16039)

Immunohistochemistry analysis of CD80 in paraffin-embedded human spleen using CD80 Rabbit pAb (A16039) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name CD80 Rabbit pAb
Catalog No. A16039
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene is a membrane receptor that is activated by the binding of CD28 or CTLA-4. The activated protein induces T-cell proliferation and cytokine production. This protein can act as a receptor for adenovirus subgroup B and may play a role in lupus neuropathy.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CD80 (NP_005182.1).
Sequence MGHTRRQGTSPSKCPYLNFFQLLVLAGLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLS
Gene ID 941
Swiss prot P33681
Synonyms B7; BB1; B7-1; B7.1; LAB7; CD28LG; CD28LG1; CD80
Calculated MW 33kDa
Observed MW 50-75kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples Rat lung
Cellular location Membrane, Single-pass type I membrane protein
Customer validation

FC (Homo sapiens)

WB (Homo sapiens, Mus musculus)

IF (Mus musculus, Rattus norvegicus, Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

CD80 Rabbit pAb images

ABclonal:Western blot - CD80 Rabbit pAb (A16039)}

Western blot - CD80 Rabbit pAb (A16039)

Western blot analysis of lysates from Rat lung, using CD80 Rabbit pAb (A16039) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.
ABclonal:Western blot - CD80 Rabbit pAb (A16039)}

Western blot - CD80 Rabbit pAb (A16039)

WWestern blot analysis of various lysates, using CD80 Rabbit pAb (A16039) at 1:900 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s.
ABclonal:Immunohistochemistry - CD80 Rabbit pAb (A16039)}

Immunohistochemistry - CD80 Rabbit pAb (A16039)

Immunohistochemistry analysis of CD80 in paraffin-embedded human spleen using CD80 Rabbit pAb (A16039) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A16039 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CD80. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CD80. (Distance between topics and target gene indicate popularity.) CD80

* Data provided by citexs.com, for reference only.

Publishing research using A16039? Please let us know so that we can cite the reference in this datasheet.

Antibodies (6)

Proteins (1)

ELISA Kits (2)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order