Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

PD-1/CD279 Rabbit pAb (A11973)

Publications (5) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - PD-1/CD279 Rabbit pAb (A11973)

Western blot analysis of various lysates using PD-1/CD279 Rabbit pAb (A11973) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Western blot - PD-1/CD279 Rabbit pAb (A11973)

Western blot analysis of various lysates using PD-1/CD279 Rabbit pAb (A11973) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates / proteins: 25 μg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunofluorescence - PD-1/CD279 Rabbit pAb (A11973)

Immunofluorescence analysis of paraffin-embedded human tonsil using PD-1/CD279 Rabbit pAb (A11973) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name PD-1/CD279 Rabbit pAb
Catalog No. A11973
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Programmed cell death protein 1 (PDCD1) is an immune-inhibitory receptor expressed in activated T cells; it is involved in the regulation of T-cell functions, including those of effector CD8+ T cells. In addition, this protein can also promote the differentiation of CD4+ T cells into T regulatory cells. PDCD1 is expressed in many types of tumors including melanomas, and has demonstrated to play a role in anti-tumor immunity. Moreover, this protein has been shown to be involved in safeguarding against autoimmunity, however, it can also contribute to the inhibition of effective anti-tumor and anti-microbial immunity.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 205-259 of human PD-1/CD279 (NP_005009.2).
Sequence TGQPLKEDPSAVPVFSVDYGELDFQWREKTPEPPVPCVPEQTEYATIVFPSGMGT
Gene ID 5133
Swiss prot Q15116
Synonyms PD1; PD-1; CD279; SLEB2; hPD-1; hPD-l; hSLE1; PD-1/CD279
Calculated MW 32kDa
Observed MW 50kDa/35kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples 293T, K-562, HL-60, MOLT-4, Mouse spleen, Rat thymus
Cellular location Membrane, Single-pass type I membrane protein
Customer validation

IHC (Homo sapiens, Rattus norvegicus)

IF (Homo sapiens)

WB (Rattus norvegicus)

RNA-Seq analysis (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

PD-1/CD279 Rabbit pAb images

ABclonal:Western blot - PD-1/CD279 Rabbit pAb (A11973)}

Western blot - PD-1/CD279 Rabbit pAb (A11973)

Western blot analysis of various lysates using PD-1/CD279 Rabbit pAb (A11973) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
ABclonal:Western blot - PD-1/CD279 Rabbit pAb (A11973)}

Western blot - PD-1/CD279 Rabbit pAb (A11973)

Western blot analysis of various lysates using PD-1/CD279 Rabbit pAb (A11973) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates / proteins: 25 μg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
ABclonal:Immunofluorescence - PD-1/CD279 Rabbit pAb (A11973)}

Immunofluorescence - PD-1/CD279 Rabbit pAb (A11973)

Immunofluorescence analysis of paraffin-embedded human tonsil using PD-1/CD279 Rabbit pAb (A11973) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A11973 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on PDCD1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to PDCD1. (Distance between topics and target gene indicate popularity.) PDCD1

* Data provided by citexs.com, for reference only.

Publishing research using A11973? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

Proteins (5)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order