Reviews (11) Publications (40) Datasheet SDS COA
Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Reactivity:Human, Mouse, Rat
Product name | [KD Validated] LC3B Rabbit pAb |
---|---|
Catalog No. | A7198 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human LC3B (NP_073729.1). |
---|---|
Sequence | MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYE |
Gene ID | 81631 |
Swiss prot | Q9GZQ8 |
Synonyms | LC3B; ATG8F; MAP1LC3B-a; MAP1A/1BLC3; 3B |
Calculated MW | 15kDa |
Observed MW | 14kDa/16kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Application key | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | 293T, NIH/3T3, C6 |
Cellular location | Cytoplasm, Cytoplasmic vesicle, Endomembrane system, Lipid-anchor, autophagosome, autophagosome membrane, cytoskeleton |
Customer validation | WB (MSC cells, Human lung cancer cell, C2C12, Mouse cells, 293T, Rat cellsMus musculus, Sus scrofa, Bombyx mori, Mus musculus, Homo sapiens, Rattus norvegicus, Danio rerio) IHC (Squamous cell carcinomaHomo sapiens, Mus musculus, Rattus norvegicus, Homo sapiens) IF (U87MGMus musculus, Mus musculus, Homo sapiens, Rattus norvegicus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com
Submit your question about A7198 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on MAP1LC3B. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to MAP1LC3B. (Distance between topics and target gene indicate popularity.) MAP1LC3B
* Data provided by citexs.com, for reference only.
Publishing research using A7198? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.